PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 328aa    MW: 37973.3 Da    PI: 6.5754
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18594.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox231.3e-072662982254
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  +yp++e++++L +++gL+ +q+ +WF N+R +
  KHN18594.1 266 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 298
                 59*****************************87 PP

2ELK29.22e-10219240122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+++++++++E++
  KHN18594.1 219 ELKHELKQGYKEKIVDIREEIL 240
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-571114IPR005540KNOX1
PfamPF037901.4E-97399IPR005540KNOX1
SMARTSM012568.2E-14114162IPR005541KNOX2
PfamPF037912.6E-11122161IPR005541KNOX2
PROSITE profilePS512139.969219239IPR005539ELK domain
SMARTSM011886.1E-4219240IPR005539ELK domain
PfamPF037897.2E-7219240IPR005539ELK domain
PROSITE profilePS5007111.612239302IPR001356Homeobox domain
SuperFamilySSF466895.56E-16241306IPR009057Homeodomain-like
SMARTSM003891.1E-10241306IPR001356Homeobox domain
CDDcd000862.14E-10242302No hitNo description
Gene3DG3DSA:1.10.10.608.4E-25246303IPR009057Homeodomain-like
PfamPF059208.4E-18259298IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAFHDHLQHE IAFQRFTEEQ ELTENRDMQQ RLPPPTWLNN VNARQQNFLD TEKSVDRNNR  60
SESNCESEDL REYKADILGH PLYDQLLSAH VSCLRIATSC NSYFLINVRF WLYHNGRIRN  120
LTHYVLLLCA FKEQLQQHVR VHAMEAVMAC WDLEQSLQSL TGVSPGEGTG ATMSDDEDDQ  180
AESNANLYEG SLDGGETLGF GPLVPTESER SLMERVRHEL KHELKQGYKE KIVDIREEIL  240
RKRRAGKLPG DTTSLLKAWW QSHSKWPYPT EEDKARLVQE TGLQLKQINN WFINQRKRNW  300
HTNNPSSSSN SKSKRKSSAG EASNQSFM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006600707.10.0PREDICTED: homeobox protein knotted-1-like 4 isoform X1
SwissprotP480011e-139KNAT4_ARATH; Homeobox protein knotted-1-like 4
TrEMBLA0A0B2QEU30.0A0A0B2QEU3_GLYSO; Homeobox protein knotted-1-like 4
STRINGGLYMA17G11330.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-132KNOTTED1-like homeobox gene 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]